Protein Labeling Reagents
Lumiprobe THPTA ligand | 760952-88-3 | MFCD27665386 | 100 mg
THPTA ligand | Purity: 95% | Mol Wt: 434.5 | 760952-88-3 | MFCD27665386 | 100 mg
Lumiprobe TAMRA azide, 5-isomer | 825651-66-9 | MFCD18426598 | 25 mg
TAMRA azide, 5-isomer | Purity: 95% | Mol Wt: 512.56 | 825651-66-9 | MFCD18426598 | 25 mg
Kyfora Bio Stains-all 5g
Stains-all is a carbocyanine dye that can be used to stain DNA and RNA as well as anionic proteins and polysaccharides In buffer solution stains-all has an absorption maxima near 570 nm and an emission maxima near 650 nm
CPC Scientific 5FAM-Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-OH (trifluoroacetate salt) 0.5MG
Synthetic peptide that forms fibrils with have the same antigenic and structural features as those of native AD amyloid filaments.ONE-LETTER SEQUENCE: 5FAM-DAEFRHDSGYEVHHQKLVFFAEDVGSNKMOLECULAR FORMULA: C166H219N41O52MOLECULAR WEIGHT:3620.8STORAGE CONDITIONS: -20 5C, CAS REGISTRY NUMBER: [109770-29-8], RESEARCH AREA: Alzheimer's DiseaseREFERENCES: J. Kang et al., Nature, 325, 773 (1987)
Medchemexpress LLC HY-D0784 10mg Medchemexpress, 5-ROX CAS:216699-35-3 Purity:>98%
Medchemexpress, HY-D0784 10mg 5-ROX CAS:216699-35-3 Purity:>98% Medchemexpress has over 10000 novel life-science reagents, reference compounds, APIs and natural compounds for laboratory and scientific use. Other quantity can also be offered.
Medchemexpress LLC Cy5-PEG3-azide | 00-00-0 | MFCD28142475 | 99.5% | 719.36 | C40H55ClN6O4 | 5 MG
Cy5-PEG3-azide is a PEG-based linker dye bearing an azide group for bioorthogonal conjugation. It is designed for use in click chemistry and linker-dependent constructs, enabling efficient attachment to alkyne-bearing partners for bioconjugation and PROTAC synthesis.
- PEG-based linker with azide functionality for click chemistry.
- Compatible with copper-catalyzed and strain-promoted azide-alkyne cycloaddition.
- Suitable for PROTAC synthesis and general bioconjugation workflows.
- High purity for reliable analytical and preparative results.
- Store at -20°C and protect from light; in solution, store at -80°C for long-term.
Medchemexpress LLC HY-D0048 10mg Medchemexpress, 5-TAMRA-SE CAS:150810-68-7 Purity:>98%
Medchemexpress, HY-D0048 10mg 5-TAMRA-SE CAS:150810-68-7 0 Purity:>98% Medchemexpress has over 10000 novel life-science reagents, reference compounds, APIs and natural compounds for laboratory and scientific use. Other quantity can also be offered.
Biotium Mix-n-Stain™ CF405M Small Ligand Labeling Kit
Mix-n-Stain™ Small Ligand Labeling Kits are designed for rapid labeling of low molecular weight (MW 150 -5000) ligands without a purification step. Suitable ligands or substrates include SNAP-tag, CLIP-tag™ and HaloTag ligand derivatives that have an aliphatic amine. CF dyes are Biotium's line of next-generation fluorescent dyes with advantages in brightness, photostability, and conjugate specificity compared to other fluorescent dyes. Blue fluorescent CF405M dye has excitation/emission at 408/452 nm. It is suitable for labeling ligands for cell surface staining. Note: Conjugates of blue fluorescent dyes are not recommended for detecting low abundance targets, because blue dyes have lower fluorescence and can give higher non-specific background than other dye colors.
CPC Scientific TAMRA-Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-OH (trifluoroacetate salt) 0.1MG
Synthetic peptide that forms fibrils with have the same antigenic and structural features as those of native AD amyloid filaments.ONE-LETTER SEQUENCE: TAMRA-DAEFRHDSGYEVHHQKLVFFAEDVGSNKMOLECULAR FORMULA: C170H230N43O50MOLECULAR WEIGHT:3676STORAGE CONDITIONS: -20 5C, CAS REGISTRY NUMBER: [109770-29-8], RESEARCH AREA: Alzheimer's DiseaseREFERENCES: J. Kang et al., Nature, 325, 773 (1987)
Apexbio Technology LLC Cy3.5 maleimide (non-sulfonated), 25mg. Cas: N/A MFCD: NA. Labeling of cysteine residues, as well as other thiolated molecules
Cy3.5 maleimide can be used for selective labeling of free sulfhydryl groups (e.g. cysteine residues in peptides, proteins and oligonucleotides). Before labeling, cystines should be prepared with reductant such as TCEP (tris-carboxyethylphosphine). Other sizes are available. Please inqury us for quote.
Aat Bioquest 6-ROX, SE [6-Carboxy-X-rhodamine, succinimidyl ester] *CAS#: 216699-36-4*
6-ROX, SE is the other purified single isomer of 5(6)-ROX, SE. 6-ROX is predominately used for labeling nucleotides and sequencing nucleic acids. Compared to other rhodamines, ROX is very unstable.
Medchemexpress LLC HY-66022 500mg Medchemexpress, 5-FAM 5-Carboxyfluorescein CAS:76823-03-5 Purity:98%
Medchemexpress,HY-66022 500mg 5-FAM 5-Carboxyfluorescein CAS:76823-03-5 Formula:C21H12O7 Purity:98% Medchemexpress has over 10000 novel life-science reagents, reference compounds, APIs and natural compounds for laboratory and scientific use. Other quantity can also be offered.